Sign In | Join Free | My disqueenfrance.com
disqueenfrance.com
Products
Search by Category
Wholesale Marketplace
Home > Furniture & Furnishings > Folding Furniture >

Cardiac Enzyme Levels

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cardiac enzyme levels

    All cardiac enzyme levels wholesalers & cardiac enzyme levels manufacturers come from members. We doesn't provide cardiac enzyme levels products or service, please contact them directly and verify their companies info carefully.

    Total 333 products from cardiac enzyme levels Manufactures & Suppliers
    China Sarm Powder Prohormone Steroids AICAR Acadesine 2627-69-2 for Bodybuilding Enhancement wholesale

    Brand Name:Pharmlab

    Model Number:2627-69-2

    Place of Origin:China

    Sarm Powder Prohormone Steroids AICAR Acadesine 2627-69-2 for Bodybuilding Enhancement Quick Details : Product Name: AICAR/ Acadesine Full name: 5-Aminoimidazole-4-carboxamide 1-β-D-ribofuranoside Alias: AICA Riboside; Acadesine CAS: 2627-69-2 MF: ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    China 99% Effective Animal Extracts Pharmaceutical Raw Powder Tauroursodeoxycholic Acid/TUDCA CAS 14605-22-2 for Liver Disord wholesale

    Brand Name:TINGYI

    Model Number:CAS: 14605-22-2

    Place of Origin:China

    Product Name: Tauroursodeoxycholic Acid Product details: Product Name Tauroursodeoxycholic Acid Alias TUDCA, Tauro ursodesoxy cholic acid,Ursodeoxycholyltaurine CAS 14605-22-2 MF C26H45NO6S MW 499.7 Purity 99.00% Grade Pharmaceutical Grade Appearance ...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier

    Chongqing

    China 99% Assays Fluvastatin Sodium Salt Oral Anabolic Powder Decreasing Cholesterol 93957-55-2 wholesale

    Brand Name:LSW

    Model Number:93957-55-2

    Place of Origin:China

    Oral Anabolic Steroids Fluvastatin Sodium Salt for Decreasing Cholesterol 93957-55-2 Quick Details: Product Name: Fluvastatin sodium salt Synonyms: (+/-)-(3R',5S',6E)-7-[3-(4-FLUOROPHENYL)-1-ISOPROPYLINDOL-2-YL]-3,5-DIHYDROXY-6-HEPTENOATE, SODIUM;...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    China Nootropic Pharmaceutical Raw Materials USP Grade 99%Min Idebenone 58186-27-9 wholesale

    Brand Name:HKYC

    Model Number:58186-27-9

    Place of Origin:China

    Quick Detail: Name: Idebenone Synonyms:4-dione,5,6-dimethoxy-2-(10-hydroxydecyl)-3-methyl-5-cyclohexadiene-1;6-(10-hydroxydecyl)-2,3-dimethoxy-5-methyl-1,4-benzoquinone;2-(10-Hydroxy-Decyl)-5,6-Dimethoxy-3-Methyl-[1,4]Benzoquinone;2-(10-hydroxydecyl)-5,6-...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    China Pharma Raw Material SARM Powder Aicar Fat Burning Hormone Powder CAS 2627-69-2 wholesale

    Brand Name:saichuang

    Model Number:SARMs raw powder

    Place of Origin:Hubei, China

    Pharma Raw Material SARM Powder Aicar Fat Burning Hormone Powder CAS 2627-69-2 Just try a small order to start our cooperation, we will NOT make you down ! Any products interested pls let me know I will give info.in details. kathelin@yccreate.com Skype:...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    China Water Soluble Apple Polyphenol Extract Powder , Green Apple Peel Extract  For Skin Health wholesale

    Brand Name:World-Way

    Model Number:Apple Extract

    Place of Origin:China

    .... The net effect is fewer glucose molecules leaving the intestine to contribute to blood sugar levels. Triglyceride is one of important parts of the blood fat. If there is too much...

    Changsha World-Way Biotech Inc
    Verified Supplier

    Hunan

    China 3 - In - 1 Physical Therapy Apparatus For Rapid Heartbeat / Seasonal Affective Disorder wholesale

    Brand Name:SSCH

    Model Number:GY-L2

    Place of Origin:China

    Laser Treatment health care products physical therapy apparatus cholesterol lllt blue/red laser 3-in-1 Semiconductor Laser treatment watch About the Laser Watch Number of red diodes: 15 (6x Watch, 6x Pad, 2x Ear Applicator, 1x Nasal Applicator) Number of ...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier

    Guangdong

    China High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation wholesale

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    China Yellow Crystalline Solid Human Growth Hormone Peptide AICAR Acadesine Fat Burning SARM Powder wholesale

    Brand Name:YIHAN

    Model Number:2627-69-2

    Place of Origin:China

    Product Details: Product Name: Hot Sell SARMS AICAR/Acadesine Cas 2627-69-2 CAS No: 2627-69-2 Molecular Formular: C9H14N4O5 Molecular Weight: 258.2 Appearance: White powder Chemical Mame: 5-Aminoimidazole-4-carboxamide ribonucleotide Package size: 1g/5g/...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    China Anabolic Steroid Raw Powder Hormone L-Thyroxine T4 For Bodybuilding CAS 51-48-9 wholesale

    Brand Name:HKYC

    Model Number:50-50-0

    Place of Origin:HUBEI,CHINA

    Anabolic Steroid Raw Powder Hormone L-Thyroxine T4 For Bodybuilding CAS 51-48-9 Just try a small order to start our cooperation, we will NOT make you down ! Any products interested pls let me know I will give info.in details. kathelin@yccreate.com Skype:...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    China AICAR Acadesine Raw SARM Steroids Body Building White Powder CAS 2627-69-2 wholesale

    Brand Name:Kafen

    Model Number:2627-69-2

    Place of Origin:China

    Basic Info Product Name Aicar Other Name Acadesine Purity 98%min by HPLC CAS No. 2627-69-2 M.W. 258.231 M.F. C9G14N4O5 Melting Point 214-215ºC Assay HPLC;HNMR;LCMS Appearance White powder Application muscle building AICAR (AICA-Riboside) strongly ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    China Healthy Effective Raw Steroids Powder L - Triiodothyronine T3 For Weight Loss wholesale

    Brand Name:HongKong Blue Universal Co., Limited.

    Model Number:55-06-1

    Place of Origin:China

    Healthy Effective Raw Steroids Powder L - Triiodothyronine T3 For Weight Loss 1. Quick Details Skype: lily_3566 My Email: lily@sinosteroids.com Name L - Triiodothyronine Aliases T3 CAS No. 55-06-1 Purity 99% Packaging Discreet and Safe Packages for Safe ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    China Safe High 99% Purity Sarms Acadesine Aicar Powder CAS 2627-69-2 For Bodybuilding wholesale

    Brand Name:TJ

    Model Number:99%

    Place of Origin:Chima

    Safe High 99% Purity Sarms Acadesine Aicar Powder CAS 2627-69-2 For Bodybuilding Quick Detail: Product Name Aicar Aicar CAS 2627-69-2 Aicar Molecular Formula C9H14N4O5 Aicar Molecular Weight 258.23 Apperance White Powder Assay 99% Grade Pharmaceutical ...

    zhuhai TianJian Chemical Co.,Ltd.
    Verified Supplier

    Guangdong

    China Winstrol Depot Cycle Injectable Anabolic Steroids CAS 10418-03-8 wholesale

    Model Number:10418-03-8

    Cutting cycle steroids stanozol winstrol depot side effects reviews for muscle mass 1. Winstrol Depot (Stanozol) Winstrol Depot(stanozolinjectable) is an anabolic steroid with interesting properties. It generally is not used as the foundation of an ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    China 99.5% Anti - Inflammatory Local Anesthetic Powder Procaine Hydrochloride CAS 51-05-8 wholesale

    Brand Name:saichuang

    Model Number:51-05-8

    Place of Origin:iso9001

    Description: Procaine hydrochloride is a local anesthetic that can temporarily block the conduction of nerve fibers and has a narcotic effect, the role of strong, low toxicity, and no addiction, but the skin, mucous membranes penetrate weak, suitable for ...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    China SARMS Raw Powder AICAR 220 - 097 - 5 penetrate Cardiac Cells White Powder wholesale

    Brand Name:HUAO

    Model Number:2627-69-2

    Place of Origin:China

    ...SARMS Raw Powder AICAR 220 - 097 - 5 penetrate Cardiac Cells White Powder Skype:live:1537611728 Whatsapp:+8615622635381 E-mail: evan@ycphar.com Web:http://www....

    Guangzhou Huao Chemical Co,ltd
    Site Member

    Guangdong

    China 3 In 1 Cardiac Blood Tests , MI Heart Related Blood Tests Dilution Tube With Buffer wholesale

    Brand Name:New Life

    Model Number:cassette

    Place of Origin:China

    ...One Step 3 in 1 Cardiac Combo cardiac blood Tests , gold colloidal method,quickly and easily, multiple cassette Accessories: Instruction for use, Specimens dilution tube with buffer Intended Use: The Cardiac Combo Rapid Test is...

    Orient New Life Medical Co.,Ltd.
    Active Member

    Zhejiang

    China 650nm Watch Type Low Level Laser Therapy Devices For Body Pain , Rhinitis wholesale

    Brand Name:BOSHI

    Model Number:BS-WP

    Place of Origin:China

    Gold Supplier China Laser Therapy Unit 650nm Watch Type For Body Pain Rhinitis Blood Fat Blood Pressure And Diabetics Applications: 1. Effective for 'Three High':High blood pressure(Hypertension),high blood fat (High cholesterol),high blood sugar(Diabetes...

    Hubei Boshi Medical Instrument Co., Ltd.
    Active Member

    Hubei

    China CAS 2627-69-2 Fat Burning Hormones AICAR 220 - 097 - 5 Penetrate Cardiac Cells wholesale

    Brand Name:HUAO

    Model Number:2627-69-2

    Place of Origin:China

    ...Fat Burning Hormones AICAR 220 - 097 - 5 Penetrate Cardiac Cells Skype:sucy1171 Whatsapp:+8618565342920 pharmacy@ycgmp.com Alias:AICAR; AICA-RIBOSIDE; AMPK; Z-RIBOSIDE CAS:...

    Guangzhou Huao Chemical Co.,Ltd
    Active Member

    Guangdong

    China Human Myosin Light Chain 2, Regulatory, Cardiac (MYL2) ELISA Kit wholesale

    Categories:Human Serum Cell Culture

    Telephone:+86-510-82732223,778-477-6628

    Country/Region:china

    ... name: Human Myosin Light Chain 2, Regulatory, Cardiac (MYL2) ELISA Kit Method: Sandwich Synonyms: CMH10; MLC2; Myosin,Light Chain 2,Regulatory,Cardiac,Slow; Myosin regulatory light chain 2, ventricular/cardiac muscle isoform Detection range: 0.156-10ng...

    Wuxi Donglin Sci & Tech Development Co.,Ltd
    ICP Remarked Supplier

    Go to Page
    Inquiry Cart 0