Sign In | Join Free | My disqueenfrance.com
disqueenfrance.com
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Other Health Care Products >

Cardiac Enzyme Levels

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cardiac enzyme levels

    All cardiac enzyme levels wholesalers & cardiac enzyme levels manufacturers come from members. We doesn't provide cardiac enzyme levels products or service, please contact them directly and verify their companies info carefully.

    Total 246 products from cardiac enzyme levels Manufactures & Suppliers
    China Diabetes Cure Laser Pain Relief Device , Laser Therapy Watch Red And Blue Color wholesale

    Brand Name:SSCH

    Model Number:GY-L2

    Place of Origin:GUANGDONG CHINA

    ... an innovative 3-in-1 device that uses the latest research findings in the field of low-level-laser therapy. The main function is to reduce high blood sugar, high blood pressure, high...

    Shenzhen Guangyang Zhongkang Technology Co., Ltd.
    Verified Supplier

    Guangdong

    China 98% Top Quality Quinine Raw Powder CAS: 130-95-0 Made Of Cinchona Bark Pharmaceutical Grade wholesale

    Brand Name:TINGYI

    Model Number:130-95-0

    Place of Origin:CHINA

    Quinine Product Name: Quinine Synonyms: Quinie;Quinine, anhydrous, 99%(total base), may cont. up to 5% dihydroquinine;Basic Quinine Hydrochloride;Chininii Chloridum;Kinin;Quinina;Quininium Chloride;Cinchonan-9-ol, 6'-methoxy-, (8α,9R)- CAS: 130-95-0 MF: ...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier

    Chongqing

    China Safe High 99% Purity Sarms Acadesine Aicar Powder CAS 2627-69-2 For Bodybuilding wholesale

    Brand Name:TJ

    Model Number:99%

    Place of Origin:Chima

    Safe High 99% Purity Sarms Acadesine Aicar Powder CAS 2627-69-2 For Bodybuilding Quick Detail: Product Name Aicar Aicar CAS 2627-69-2 Aicar Molecular Formula C9H14N4O5 Aicar Molecular Weight 258.23 Apperance White Powder Assay 99% Grade Pharmaceutical ...

    zhuhai TianJian Chemical Co.,Ltd.
    Verified Supplier

    Guangdong

    China Sarm Powder Prohormone Steroids AICAR Acadesine 2627-69-2 for Bodybuilding Enhancement wholesale

    Brand Name:Pharmlab

    Model Number:2627-69-2

    Place of Origin:China

    Sarm Powder Prohormone Steroids AICAR Acadesine 2627-69-2 for Bodybuilding Enhancement Quick Details : Product Name: AICAR/ Acadesine Full name: 5-Aminoimidazole-4-carboxamide 1-β-D-ribofuranoside Alias: AICA Riboside; Acadesine CAS: 2627-69-2 MF: ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    China Anti - Aging Drug Raw Powder CAS 1094-61-7 β-NMN/ Beta - Nicotinamide Mononucleotide wholesale

    Brand Name:YIHAN

    Model Number:1094-61-7

    Place of Origin:China

    Anti-Aging Drug Raw powder CAS 1094-61-7 β-NMN/Beta-Nicotinamide Mononucleotide 1. Basic Info β-NMN Beta-Nicotinamide Mononucleotide β-NMN CAS: 1094-61-7 β-NMN Assay:99.5% β-NMN MF: C11H15N2O8P β-NMN MW: 334.22 β-NMN EINECS: 214-136-5 β-NMN ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    China 99% Assays Fluvastatin Sodium Salt Oral Anabolic Powder Decreasing Cholesterol 93957-55-2 wholesale

    Brand Name:LSW

    Model Number:93957-55-2

    Place of Origin:China

    Oral Anabolic Steroids Fluvastatin Sodium Salt for Decreasing Cholesterol 93957-55-2 Quick Details: Product Name: Fluvastatin sodium salt Synonyms: (+/-)-(3R',5S',6E)-7-[3-(4-FLUOROPHENYL)-1-ISOPROPYLINDOL-2-YL]-3,5-DIHYDROXY-6-HEPTENOATE, SODIUM;...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    China White Powder Aicar Pharmaceutical Intermediate , Pharmaceutical Ingredient 2627-69-2 wholesale

    Brand Name:XinRunde

    Model Number:2627-69-2

    Place of Origin:China(Mainland)

    High Quality white powder Aicar/2627-69-2 with Best Price in Stock Quick detail: Product Name Aicar Aicar CAS 2627-69-2 Aicar Molecular Formula C9H14N4O5 Aicar Molecular Weight 258.23 Apperance White Powder Assay 99% Grade Pharmaceutical Grade Delivery ...

    Hubei XinRunde Chemical Co., Ltd
    Verified Supplier

    Hubei

    China Nootropic Pharmaceutical Raw Materials USP Grade 99%Min Idebenone 58186-27-9 wholesale

    Brand Name:HKYC

    Model Number:58186-27-9

    Place of Origin:China

    Quick Detail: Name: Idebenone Synonyms:4-dione,5,6-dimethoxy-2-(10-hydroxydecyl)-3-methyl-5-cyclohexadiene-1;6-(10-hydroxydecyl)-2,3-dimethoxy-5-methyl-1,4-benzoquinone;2-(10-Hydroxy-Decyl)-5,6-Dimethoxy-3-Methyl-[1,4]Benzoquinone;2-(10-hydroxydecyl)-5,6-...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    China Effective Aicar Acadesine Peptide Drug Sarms Steroids Oral Powder 2627-69-2 wholesale

    Brand Name:WHYC

    Model Number:Aicar CAS 2627-69-2

    Place of Origin:Wuhan,Hubei,China

    Aicar Factory Supply CAS 2627-69-2 Sarms Steroids 99% Acadesine Description: AICAR is a peptide whose technical name is 5-Aminoimidazole-4-carboxamide ribonucleotide. It can also be known as AICA ribonucleotide, ZMP, or Acadesine. It is an intermediate ...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    China Pharma Raw Material SARM Powder Aicar Fat Burning Hormone Powder CAS 2627-69-2 wholesale

    Brand Name:saichuang

    Model Number:SARMs raw powder

    Place of Origin:Hubei, China

    Pharma Raw Material SARM Powder Aicar Fat Burning Hormone Powder CAS 2627-69-2 Just try a small order to start our cooperation, we will NOT make you down ! Any products interested pls let me know I will give info.in details. kathelin@yccreate.com Skype:...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    China Water Soluble Apple Polyphenol Extract Powder , Green Apple Peel Extract  For Skin Health wholesale

    Brand Name:World-Way

    Model Number:Apple Extract

    Place of Origin:China

    .... The net effect is fewer glucose molecules leaving the intestine to contribute to blood sugar levels. Triglyceride is one of important parts of the blood fat. If there is too much...

    Changsha World-Way Biotech Inc
    Verified Supplier

    Hunan

    China High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation wholesale

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    China Yellow Crystalline Solid Human Growth Hormone Peptide AICAR Acadesine Fat Burning SARM Powder wholesale

    Brand Name:YIHAN

    Model Number:2627-69-2

    Place of Origin:China

    Product Details: Product Name: Hot Sell SARMS AICAR/Acadesine Cas 2627-69-2 CAS No: 2627-69-2 Molecular Formular: C9H14N4O5 Molecular Weight: 258.2 Appearance: White powder Chemical Mame: 5-Aminoimidazole-4-carboxamide ribonucleotide Package size: 1g/5g/...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    China 99.5% Anti - Inflammatory Local Anesthetic Powder Procaine Hydrochloride CAS 51-05-8 wholesale

    Brand Name:Saichuang

    Model Number:51-05-8

    Place of Origin:Wuhan,Hubei

    Description Procaine hydrochloride is a local anesthetic that can temporarily block the conduction of nerve fibers and has a narcotic effect, the role of strong, low toxicity, and no addiction, but the skin, mucous membranes penetrate weak, suitable for ...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    China Anabolic Steroid Raw Powder Hormone L-Thyroxine T4 For Bodybuilding CAS 51-48-9 wholesale

    Brand Name:HKYC

    Model Number:50-50-0

    Place of Origin:HUBEI,CHINA

    Anabolic Steroid Raw Powder Hormone L-Thyroxine T4 For Bodybuilding CAS 51-48-9 Just try a small order to start our cooperation, we will NOT make you down ! Any products interested pls let me know I will give info.in details. kathelin@yccreate.com Skype:...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    China AICAR Acadesine Raw SARM Steroids Body Building White Powder CAS 2627-69-2 wholesale

    Brand Name:Kafen

    Model Number:2627-69-2

    Place of Origin:China

    Basic Info Product Name Aicar Other Name Acadesine Purity 98%min by HPLC CAS No. 2627-69-2 M.W. 258.231 M.F. C9G14N4O5 Melting Point 214-215ºC Assay HPLC;HNMR;LCMS Appearance White powder Application muscle building AICAR (AICA-Riboside) strongly ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    China SARMS Raw Powder AICAR 220 - 097 - 5 penetrate Cardiac Cells White Powder wholesale

    Brand Name:HUAO

    Model Number:2627-69-2

    Place of Origin:China

    ...SARMS Raw Powder AICAR 220 - 097 - 5 penetrate Cardiac Cells White Powder Skype:live:1537611728 Whatsapp:+8615622635381 E-mail: evan@ycphar.com Web:http://www....

    Guangzhou Huao Chemical Co,ltd
    Site Member

    Guangdong

    China 650nm Watch Type Low Level Laser Therapy Devices For Body Pain , Rhinitis wholesale

    Brand Name:BOSHI

    Model Number:BS-WP

    Place of Origin:China

    Gold Supplier China Laser Therapy Unit 650nm Watch Type For Body Pain Rhinitis Blood Fat Blood Pressure And Diabetics Applications: 1. Effective for 'Three High':High blood pressure(Hypertension),high blood fat (High cholesterol),high blood sugar(Diabetes...

    Hubei Boshi Medical Instrument Co., Ltd.
    Active Member

    Hubei

    China 99% Purity Selective Androgen Receptor Modulator Raw Powder Acadesine Sarms Aicar CAS: 2627-69-2 wholesale

    Brand Name:Muscle Man

    Model Number:CAS: 2627-69-2

    Place of Origin:Hunan,China

    99% Purity Selective Androgen Receptor Modulator Raw Powder Acadesine Sarms Aicar CAS: 2627-69-2 Quick Detail: Product Name Aicar Aicar Alias Acadesine Aicar CAS 2627-69-2 Aicar Molecular Formula C9H14N4O5 Aicar Molecular weight 258.23 Aicar Apperance Off...

    Zhuzhou Interial Biotechnology Co., Ltd
    Site Member

    Hunan

    China Fludarabine Phosphate For Injection 50MG Anti cancer Medicine wholesale

    Brand Name:ZMC

    Model Number:250MG

    Place of Origin:China

    Fludarabine Phosphate For Injection 50MG Anticancer Medicine COMPOSITION: Each vial contains 50 mg fludarabine phosphate as a lyophilised solid cake (equivalent to 39,05 mg fludarabine per vial). PHARMACOLOGICAL ACTION: Pharmacodynamic properties ...

    ZHEJIANG HEALTH LIFE CO.,LTD
    Site Member

    Zhejiang

    Go to Page
    Inquiry Cart 0